Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGENFATPFHGHVGRGAFSDVYEPAE DTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTD INPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVV TPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKEN NPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 214
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No. NP_037372

Specifications

Our Abpromise guarantee covers the use of ab187466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab187466 is purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 79% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • C21orf127
    • Chromosome 21 open reading frame 127
    • EC 2.1.1.-
    • HemK methyltransferase family member 2
    • HemK2
    • M.HsaHemK2P
    • MGC19995
    • MTQ2
    • N-6 adenine-specific DNA methyltransferase 1
    • N-6 adenine-specific DNA methyltransferase 1 (putative)
    • N6-DNA-methyltransferase
    • N6AMT
    • N6AMT1
    • OTTHUMP00000096393
    • OTTHUMP00000096394
    • PRED28
    see all
  • Relevance
    The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Images

  • 15% SDS-PAGE analysis of ab187466 (3μg).

References

ab187466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up