Recombinant Human Hemoglobin subunit alpha protein (ab88849)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • AccessionP69905
    • SpeciesHuman
    • SequenceMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLS HGSAQ VKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVN FKLLSHCLLVTL AAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88849 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Alpha 1 globin
    • Alpha globin
    • Alpha one globin
    • Alpha-globin
    • HBA_HUMAN
    • HBA1
    • HBA2
    • Hemoglobin alpha 1
    • Hemoglobin alpha 1 chain
    • Hemoglobin alpha 1 globin chain
    • Hemoglobin alpha 2
    • Hemoglobin alpha chain
    • Hemoglobin subunit alpha
    • MGC126895
    • MGC126897
    see all
  • FunctionInvolved in oxygen transport from the lung to the various peripheral tissues.
  • Tissue specificityRed blood cells.
  • Involvement in diseaseHeinz body anemias
    Alpha-thalassemia
    Alpha(0)-thalassemia is associated with non-immune hydrops fetalis, a generalized edema of the fetus with fluid accumulation in the body cavities due to non-immune causes. Non-immune hydrops fetalis is not a diagnosis in itself but a symptom, a feature of many genetic disorders, and the end-stage of a wide variety of disorders.
    Hemoglobin H disease
  • Sequence similaritiesBelongs to the globin family.
  • Post-translational
    modifications
    The initiator Met is not cleaved in variant Thionville and is acetylated.
  • Information by UniProt

References for Recombinant Human Hemoglobin subunit alpha protein (ab88849)

ab88849 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

The GST tag should be cleaved off with thrombin, according to our source for the tagged Hemoglobin subunit alpha protein, ab88849.

Please do not hesitate to contact us if you have any other questions.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"