Recombinant Human Hemoglobin subunit beta protein (ab158639)

Overview

  • Product name
    Recombinant Human Hemoglobin subunit beta protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFA TLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAG VANALPHKYH
    • Amino acids
      38 to 147
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ba1
    • Beta 1 globin
    • beta globin
    • beta globin chain
    • BETA GLOBIN TYPE
    • BETA THALASSEMIAS
    • Beta-A1-globin
    • CD113t C
    • CD113t-C
    • ERYTHREMIA
    • HBB
    • Hemoglobin beta 1 chain
    • hemoglobin beta chain
    • hemoglobin beta chain complex
    • Hemoglobin beta chain, major form
    • HEMOGLOBIN BETA LOCUS
    • Hemoglobin beta-1 chain
    • Hemoglobin subunit beta-1
    • METHEMOGLOBINEMIA
    see all
  • Relevance
    The alpha and beta loci determine the structure of the 2 types of polypeptide chains in the adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Absence of beta chain causes beta-zero-thalassemia whereas mutant beta globlin causes sickle cell anemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia.
  • Cellular localization
    Haemoglobin complex, red blood cells.

Images

  • ab158639 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up