Recombinant Human Hemoglobin subunit gamma-1 protein (ab156712)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMGHFTEEDKATITSLWGKVNVEDAGGE TLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATK HLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEV QASWQKMVTAVASALSSRYH
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 147
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Gamma-1-globin
    • Hb F Agamma
    • HBG1
    • HBG1_HUMAN
    • Hemoglobin gamma-1 chain
    • Hemoglobin gamma-A chain
    • Hemoglobin subunit gamma-1
    see all
  • Function
    Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
  • Tissue specificity
    Red blood cells.
  • Sequence similarities
    Belongs to the globin family.
  • Developmental stage
    Expressed until four or five weeks after birth.
  • Post-translational
    modifications
    Acetylation of Gly-2 converts Hb F to the minor Hb F1.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156712 (3µg).

References

ab156712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up