Recombinant Human Hepsin protein (ab114907)

Overview

  • Product nameRecombinant Human Hepsin protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP05981
    • SpeciesHuman
    • SequenceVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLS CEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCD CPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCG GSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVY HGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGK ICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCA GYPEGGIDACQGDSGGPFACEDSISRTPRWRLCGIVSWGTGCALAQKPGV YTKVSDFREWIFQAIKTHSEASGMVTQL
    • Molecular weight68 kDa including tags
    • Amino acids40 to 417

Specifications

Our Abpromise guarantee covers the use of ab114907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.4.21.
    • HEPS
    • HEPS_HUMAN
    • Hepsin
    • Hpn
    • Serine protease hepsin
    • Serine protease hepsin catalytic chain
    • Serine protease hepsin non catalytic chain
    • TMPRSS 1
    • TMPRSS1
    • Transmembrane protease serine 1
    see all
  • FunctionPlays an essential role in cell growth and maintenance of cell morphology.
  • Tissue specificityPresent in most tissues, with the highest level in liver.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Hepsin protein images

  • 12.5% SDS-PAGE showing ab114907 at approximately 67.69kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Hepsin protein (ab114907)

ab114907 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"