Recombinant Human Hepsin protein (ab114907)

Overview

  • Product name
    Recombinant Human Hepsin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLS CEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCD CPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCG GSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVY HGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGK ICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCA GYPEGGIDACQGDSGGPFACEDSISRTPRWRLCGIVSWGTGCALAQKPGV YTKVSDFREWIFQAIKTHSEASGMVTQL
    • Molecular weight
      68 kDa including tags
    • Amino acids
      40 to 417

Specifications

Our Abpromise guarantee covers the use of ab114907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.4.21.
    • HEPS
    • HEPS_HUMAN
    • Hepsin
    • Hpn
    • Serine protease hepsin
    • Serine protease hepsin catalytic chain
    • Serine protease hepsin non catalytic chain
    • TMPRSS 1
    • TMPRSS1
    • Transmembrane protease serine 1
    see all
  • Function
    Plays an essential role in cell growth and maintenance of cell morphology.
  • Tissue specificity
    Present in most tissues, with the highest level in liver.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114907 at approximately 67.69kDa.
    Stained with Coomassie Blue.

References

ab114907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up