Recombinant Human HERPUD2 protein (ab163807)

Overview

  • Product name
    Recombinant Human HERPUD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL TKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTN RESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQ TDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH QYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQEN RPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFS RFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLEL EEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEG PPQVAN
    • Amino acids
      1 to 406
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22313
    • FLJ31032
    • HERP2_HUMAN
    • HERPUD 2
    • HERPUD family member 2
    • HERPUD2
    • Homocysteine inducible endoplasmic reticulum stress inducible ubiquitin like domain member 2
    • Homocysteine responsive endoplasmic reticulum resident ubiquitin like domain member 2 protein
    • Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
    • OTTHUMP00000158869
    see all
  • Function
    Could be involved in the unfolded protein response (UPR) pathway.
  • Sequence similarities
    Contains 1 ubiquitin-like domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163807 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up