Recombinant Human HERVK18.2 protein (ab114906)

Overview

  • Product name
    Recombinant Human HERVK18.2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PQGMLNSPTICQTFVAQVLQPVRDKFSDCYIIHYVDDILCAAETRDKLID CYTFLQTEVANAGLTIASDKIQTSTPFHYLGMQVEERKIKPQKVEIRKDT LRTLNDFKNC
    • Molecular weight
      38 kDa including tags
    • Amino acids
      88 to 197
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Envelope polyprotein
    • HERV-K(C1a) envelope protein
    • HERV-K_1q23.3 provirus ancestral Env polyprotein
    • HERV-K110 envelope protein
    • HERV-K18 envelope protein
    • HERV-K18 superantigen
    • IDDMK1,2 22 envelope protein
    • IDDMK1,2 22 superantigen
    see all
  • Relevance
    HERVK18.2 is a retroviral envelope protein. These proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This envelope protein has superantigenic properties. It is expressed at higher level in the thymus. It is expressed at lower level in peripheral blood lymphocytes.

Recombinant Human HERVK18.2 protein images

  • 12.5% SDS-PAGE showing ab114906 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HERVK18.2 protein (ab114906)

ab114906 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up