Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTV KHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEV RTRLLGH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      36 to 142

Specifications

Our Abpromise guarantee covers the use of ab114192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • bHLHb39
    • C-HAIRY1
    • c-hairy1A
    • Class B basic helix-loop-helix protein 39
    • FLJ20408
    • Hairy and enhancer of split 1
    • Hairy and enhancer of split 1 (Drosophila)
    • Hairy homolog
    • Hairy homolog (Drosophila)
    • Hairy like
    • Hairy, Drosophila, homolog of
    • Hairy-like protein
    • Hairy/enhancer of split, Drosophila, homolog of, 1
    • HAIRY1
    • HES-1
    • hes1
    • Hes1 hairy and enhancer of split 1 (Drosophila)
    • HES1_HUMAN
    • HHL
    • HL
    • HRY
    • MGC129109
    • OTTHUMP00000209031
    • RHL
    • Transcription factor HES-1
    see all
  • Function
    Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 Orange domain.
  • Domain
    Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).
    The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.
    The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114192 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up