Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14469
    • SpeciesHuman
    • SequenceKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTV KHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEV RTRLLGH
    • Molecular weight37 kDa including tags
    • Amino acids36 to 142

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • bHLHb39
    • C-HAIRY1
    • c-hairy1A
    • Class B basic helix-loop-helix protein 39
    • FLJ20408
    • Hairy and enhancer of split 1
    • Hairy and enhancer of split 1 (Drosophila)
    • Hairy homolog
    • Hairy homolog (Drosophila)
    • Hairy like
    • Hairy, Drosophila, homolog of
    • Hairy-like protein
    • Hairy/enhancer of split, Drosophila, homolog of, 1
    • HAIRY1
    • HES-1
    • hes1
    • Hes1 hairy and enhancer of split 1 (Drosophila)
    • HES1_HUMAN
    • HHL
    • HL
    • HRY
    • MGC129109
    • OTTHUMP00000209031
    • RHL
    • Transcription factor HES-1
    see all
  • FunctionTranscriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 Orange domain.
  • DomainHas a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).
    The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.
    The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Hes1 protein images

  • ab114192 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Hes1 protein (ab114192)

ab114192 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"