Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSA KPGPALWPLPLSVKMTPNLL HLAPENFYISHSPNSTAGPSCTLLEEAF RRYHGYIFGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAF PNISSD ESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIID SPRFSHRGILIDTS RHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSF PYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARL RGIRVLPEFDTP GHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISE VFPDQFIH LGGDEVEFKCWESNPKIQDFMRQKGFGTDFKKLESFYIQK VLDIIATINKGSIVWQEVFDDKAKLAPGTI VEVWKDSAYPEELSRVTA SGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQLFIGGEACL WG EYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRM VERGIAAQPLYAGYCNHENM
    • Molecular weight
      87 kDa including tags
    • Amino acids
      1 to 556

Specifications

Our Abpromise guarantee covers the use of ab114915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta hexosaminidase beta chain
    • Beta hexosaminidase subunit beta
    • Beta N acetylhexosaminidase
    • Beta-hexosaminidase subunit beta chain A
    • Beta-N-acetylhexosaminidase subunit beta
    • Cervical cancer proto oncogene 7 protein
    • Cervical cancer proto-oncogene 7 protein
    • ENC 1AS
    • Epididymis luminal protein 248
    • HCC 7
    • HCC-7
    • HCC7
    • HEL 248
    • HEX B
    • Hexb
    • HEXB_HUMAN
    • Hexosaminidase B
    • Hexosaminidase B (beta polypeptide)
    • Hexosaminidase subunit B
    • HexosaminidaseB
    • N acetyl beta glucosaminidase
    • N-acetyl-beta-glucosaminidase subunit beta
    see all
  • Function
    Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues.
  • Involvement in disease
    Defects in HEXB are the cause of GM2-gangliosidosis type 2 (GM2G2) [MIM:268800]; also known as Sandhoff disease. GM2-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM2 gangliosides in the neuronal cells. GM2G2 is clinically indistinguishable from GM2-gangliosidosis type 1, presenting startle reactions, early blindness, progressive motor and mental deterioration, macrocephaly and cherry-red spots on the macula.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 20 family.
  • Post-translational
    modifications
    N-linked glycans at Asn-142 and Asn-190 consist of Man(3)-GlcNAc(2) and Man(5 to 7)-GlcNAc(2), respectively.
    The beta-A and beta-B chains are produced by proteolytic processing of the precursor beta chain.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114915 at approximately 87.23kDa.
    Stained with Coomassie Blue.

References

ab114915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up