Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP07686
    • SpeciesHuman
    • SequenceMELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSA KPGPALWPLPLSVKMTPNLL HLAPENFYISHSPNSTAGPSCTLLEEAF RRYHGYIFGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAF PNISSD ESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIID SPRFSHRGILIDTS RHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSF PYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARL RGIRVLPEFDTP GHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISE VFPDQFIH LGGDEVEFKCWESNPKIQDFMRQKGFGTDFKKLESFYIQK VLDIIATINKGSIVWQEVFDDKAKLAPGTI VEVWKDSAYPEELSRVTA SGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQLFIGGEACL WG EYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRM VERGIAAQPLYAGYCNHENM
    • Molecular weight87 kDa including tags
    • Amino acids1 to 556

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta hexosaminidase beta chain
    • Beta hexosaminidase subunit beta
    • Beta N acetylhexosaminidase
    • Beta-hexosaminidase subunit beta chain A
    • Beta-N-acetylhexosaminidase subunit beta
    • Cervical cancer proto oncogene 7 protein
    • Cervical cancer proto-oncogene 7 protein
    • ENC 1AS
    • Epididymis luminal protein 248
    • HCC 7
    • HCC-7
    • HCC7
    • HEL 248
    • HEX B
    • Hexb
    • HEXB_HUMAN
    • Hexosaminidase B
    • Hexosaminidase B (beta polypeptide)
    • Hexosaminidase subunit B
    • HexosaminidaseB
    • N acetyl beta glucosaminidase
    • N-acetyl-beta-glucosaminidase subunit beta
    see all
  • FunctionResponsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues.
  • Involvement in diseaseDefects in HEXB are the cause of GM2-gangliosidosis type 2 (GM2G2) [MIM:268800]; also known as Sandhoff disease. GM2-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM2 gangliosides in the neuronal cells. GM2G2 is clinically indistinguishable from GM2-gangliosidosis type 1, presenting startle reactions, early blindness, progressive motor and mental deterioration, macrocephaly and cherry-red spots on the macula.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 20 family.
  • Post-translational
    modifications
    N-linked glycans at Asn-142 and Asn-190 consist of Man(3)-GlcNAc(2) and Man(5 to 7)-GlcNAc(2), respectively.
    The beta-A and beta-B chains are produced by proteolytic processing of the precursor beta chain.
  • Cellular localizationLysosome.
  • Information by UniProt

Recombinant Human HEXB protein images

  • 12.5% SDS-PAGE showing ab114915 at approximately 87.23kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HEXB protein (ab114915)

ab114915 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"