Overview

  • Product name
    Recombinant Human HEXDC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEFVLKHTAFAHLREVGSFPCTLNPHEAESLALVGAMIDQVLELHPGAQR LHIGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRAVASGVKARRPSV TPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYTADLDVYGKVLLMQKYR RCGFPQLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQG IILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLL GISSLEKTDPVRQAPCSPPCPLLPLPFPRPWRQLFSAGLSAGRGPAPSLA ATSLPLSHKSASICAALWMRCWRATGMSLAGSAPTTASGSSSTRSWFSTS SPQRSASWHSGAPSCRSWRLPCSWLSTRMPWRSGWRKTCTPACSGCKLCC RTSARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEAGGALHCQMAWAIR AHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPAL
    • Amino acids
      1 to 493
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta hexosaminidase D
    • Beta N acetylhexosaminidase
    • FLJ23825
    • Hexosaminidase (glycosyl hydrolase family 20 catalytic domain) containing
    • Hexosaminidase D
    • Hexosaminidase domain containing protein
    • N acetyl beta galactosaminidase
    see all
  • Relevance
    HEXDC, also known as Hexosaminidase domain containing protein, belongs to the glycosyl hydrolase 20 family. It has hexosaminidase activity and catalyses the hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides. There are 2 named isoforms produced by alternative splicing.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab166156 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up