Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAP ALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSA PPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKW ITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQ YAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQL LREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQG ELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHG RHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLF EAGDATLASDLQDWASVGAFL
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 421

Specifications

Our Abpromise guarantee covers the use of ab152389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FKHL13
    • Forkhead box J1
    • Forkhead box protein J1
    • Forkhead Homologue 4
    • Forkhead related protein FKHL13
    • Forkhead-related protein FKHL13
    • Fox J1
    • Foxj1
    • FOXJ1_HUMAN
    • Hepatocyte nuclear factor 3 forkhead homolog 4
    • HFH 4
    • HFH-4
    • HFH4
    • HNF 3/forkhead homolog 4
    • MGC35202
    see all
  • Function
    May play an important role in cell fate determination during lung development and in spermatogenesis.
  • Tissue specificity
    Testis, oviduct, lung and brain cortex.
  • Involvement in disease
    Genetic variations in FOXJ1 may be associated with susceptibility to allergic rhinitis (ALRH) [MIM:607154]. Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure.
  • Sequence similarities
    Contains 1 fork-head DNA-binding domain.
  • Developmental stage
    Expressed in developing lung, kidney and central nervous system.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152389 stained with Coomassie Blue.

References

ab152389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up