Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLP FTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIG KGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPR GEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKI CQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWE YCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDS QYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIP NCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPD ASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLD HPVISCAKTKQLR
    • Amino acids
      32 to 494
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 50% Glycerol
    Note: Buffered with Tris or PBS.

General Info

  • Alternative names
    • DFNB39
    • F TCF
    • Fibroblast derived tumor cytotoxic factor
    • Hepatocyte growth factor
    • Hepatocyte growth factor (hepapoietin A; scatter factor)
    • Hepatocyte growth factor beta chain
    • Hepatocyte growth factor precursor
    • Hepatopoietin A
    • Hepatopoietin-A
    • Hgf
    • HGF_HUMAN
    • HGFB
    • HPTA
    • Lung fibroblast derived mitogen
    • OTTHUMP00000161349
    • OTTHUMP00000206710
    • OTTHUMP00000206711
    • OTTHUMP00000206712
    • OTTHUMP00000206713
    • OTTHUMP00000206730
    • Scatter factor
    • SF
    see all
  • Function
    Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
  • Involvement in disease
    Deafness, autosomal recessive, 39
  • Sequence similarities
    Belongs to the peptidase S1 family. Plasminogen subfamily.
    Contains 4 kringle domains.
    Contains 1 PAN domain.
    Contains 1 peptidase S1 domain.
  • Information by UniProt

Images

  • ab166881 is >95% pure by SDS-PAGE.

References

ab166881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up