Recombinant Human HGFA Inhibitor 1 protein (ab114868)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43278
    • SpeciesHuman
    • SequenceMAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADC LNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLA LVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYR QLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRV ERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYC LASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC RGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDE AACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHC ARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEM AVAVFLVICIVVVVAILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTED TEHLVYNHTTRPL
    • Molecular weight83 kDa including tags
    • Amino acids1 to 513

Specifications

Our Abpromise guarantee covers the use of ab114868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HAI
    • HAI 1
    • HAI-1
    • HAI1
    • Hepatocyte growth factor activator inhibitor type 1
    • Kunitz type protease inhibitor 1
    • Kunitz-type protease inhibitor 1
    • MANSC2
    • Serine peptidase inhibitor Kunitz type 1
    • SPINT1
    • SPIT1_HUMAN
    see all
  • FunctionInhibitor of HGF activator. Also acts as an inhibitor of matriptase (ST14).
  • Sequence similaritiesContains 2 BPTI/Kunitz inhibitor domains.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MANSC domain.
  • DomainThis inhibitor contains two inhibitory domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human HGFA Inhibitor 1 protein images

  • 12.5% SDS-PAGE showing ab114868 at approximately 82.50kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HGFA Inhibitor 1 protein (ab114868)

ab114868 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"