Recombinant Human HGFA Inhibitor 1 protein (ab114868)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADC LNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLA LVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYR QLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRV ERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYC LASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC RGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDE AACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHC ARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEM AVAVFLVICIVVVVAILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTED TEHLVYNHTTRPL
    • Molecular weight
      83 kDa including tags
    • Amino acids
      1 to 513

Specifications

Our Abpromise guarantee covers the use of ab114868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HAI
    • HAI 1
    • HAI-1
    • HAI1
    • Hepatocyte growth factor activator inhibitor type 1
    • Kunitz type protease inhibitor 1
    • Kunitz-type protease inhibitor 1
    • MANSC2
    • Serine peptidase inhibitor Kunitz type 1
    • SPINT1
    • SPIT1_HUMAN
    see all
  • Function
    Inhibitor of HGF activator. Also acts as an inhibitor of matriptase (ST14).
  • Sequence similarities
    Contains 2 BPTI/Kunitz inhibitor domains.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MANSC domain.
  • Domain
    This inhibitor contains two inhibitory domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114868 at approximately 82.50kDa.
    Stained with Coomassie Blue.

References

ab114868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up