Overview

  • Product name
    Recombinant Human HHAT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG LKKDATDFEWSFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLY GMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCSLLLLSTLRLQ GVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYS FPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGLGR LLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYV YIPVGGSQHGLLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVEN GVRRLVETPCIQDSLARYFSPQARRRFHAALASCSTSMLILSNLVFLGGN EVGKTYWNRIFIQGWPWVTLSVLGFLYCYSHVGIAWAQTYATD
    • Amino acids
      1 to 493
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810432O22Rik
    • AC115917.1
    • AI462858
    • FLJ10724
    • FLJ34867
    • Hedgehog acyltransferase
    • Hhat
    • HHAT_HUMAN
    • MART 2
    • MART-2
    • MART2
    • Melanoma antigen recognized by T cells 2
    • Melanoma antigen recognized by T-cells 2
    • MGC11697
    • OTTMUSP00000033669
    • Protein cysteine N palmitoyltransferase HHAT
    • Protein-cysteine N-palmitoyltransferase HHAT
    • RGD1311746
    • SKI1
    • Skinny hedgehog protein
    • Skinny hedgehog protein 1
    • Skn
    see all
  • Function
    Catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling. May bind GTP.
  • Tissue specificity
    Ubiquitously expressed in normal tissues and cancer cell lines.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family. HHAT subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab163192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up