Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD
    • Amino acids
      157 to 206
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C3orf3
    • Glycerol uptake/transporter homolog
    • GUP1
    • GUP1 glycerol uptake/transporter homolog
    • Hedgehog acyltransferase like
    • Hedgehog acyltransferase-like protein
    • Hhatl
    • HHATL_HUMAN
    • KIAA1173
    • MBOAT3
    • Membrane bound O acyltransferase domain containing 3
    • MSTP002
    • OACT3
    • Protein-cysteine N-palmitoyltransferase HHAT-like protein
    see all
  • Function
    Negatively regulates N-terminal palmitoylation of SHH by HHAT/SKN.
  • Tissue specificity
    Heart-specific.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family. HHAT subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab163557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up