Recombinant Human hHR23A protein (ab152648)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIY AGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESS TSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGRE EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ NPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENL AANFLLSQNFDDE
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 363

Specifications

Our Abpromise guarantee covers the use of ab152648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hHR 23A
    • hHR23A
    • HR23A
    • MGC111083
    • RAD 23a
    • RAD23 homolog A
    • RAD23 homolog A (S. cerevisiae)
    • RAD23 yeast homolog A
    • RAD23A
    • RD23A_HUMAN
    • UV excision repair protein RAD23
    • UV excision repair protein RAD23 homolog A
    see all
  • Function
    Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.
    Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize XPC.
    Involved in vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 vpr with the host proteasome.
  • Sequence similarities
    Belongs to the RAD23 family.
    Contains 2 UBA domains.
    Contains 1 ubiquitin-like domain.
  • Domain
    The ubiquitin-like domain mediates interaction with ATXN3.
    The ubiquitin-like (UBL) and the UBA (ubiquitin-associated) domains interact intramolecularly in a highly dynamic manner, as each UBA domain competes for an overlapping UBL domain surface. Binding of ubiquitin or proteasome subunit PSMD4 disrupt the UBL-UBA domain interactions and drive RAD23A in to an open conformation.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152648 stained with Coomassie Blue.

References

ab152648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up