Recombinant Human hHR23b protein (ab114493)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP54727
    • SpeciesHuman
    • SequencePQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
    • Molecular weight37 kDa including tags
    • Amino acids311 to 409

Specifications

Our Abpromise guarantee covers the use of ab114493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hHR 23b
    • hHR23B
    • HR 23B
    • HR23B
    • mHR 23B
    • mHR23B
    • p58
    • RAD 23B
    • RAD23 (S. cerevisiae) homolog B
    • RAD23 homolog B
    • RAD23 homolog B (S. cerevisiae)
    • RAD23 yeast homolog of B
    • Rad23b
    • RD23B_HUMAN
    • UV excision repair protein RAD23 homolog B
    • XP C repair complementing complex 58 kDa
    • XP C repair complementing complex 58 kDa protein
    • XP C repair complementing protein
    • XP-C repair-complementing complex 58 kDa protein
    • XPC repair complementing complex 58 kDa
    • XPC repair complementing complex 58 kDa protein
    • XPC repair complementing protein
    see all
  • FunctionMultiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome. May play a role in endoplasmatic reticulum-associated degradation (ERAD) of misfolded glycoproteins by association with PNGase and delivering deglycosylated proteins to the proteasome.
    Involved in global genome nucleotide excision repair (GG-NER) by acting as component of the XPC complex. Cooperatively with CETN2 appears to stabilize XPC. May protect XPC from proteasomal degradation.
    The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair. In vitro, the XPC:RAD23B dimer is sufficient to initiate NER; it preferentially binds to cisplatin and UV-damaged double-stranded DNA and also binds to a variety of chemically and structurally diverse DNA adducts. XPC:RAD23B contacts DNA both 5' and 3' of a cisplatin lesion with a preference for the 5' side. XPC:RAD23B induces a bend in DNA upon binding. XPC:RAD23B stimulates the activity of DNA glycosylases TDG and SMUG1.
  • Sequence similaritiesBelongs to the RAD23 family.
    Contains 1 STI1 domain.
    Contains 2 UBA domains.
    Contains 1 ubiquitin-like domain.
  • DomainThe ubiquitin-like domain mediates interaction with ATXN3.
  • Cellular localizationNucleus. Cytoplasm. The intracellular distribution is cell cycle dependent. Localized to the nucleus and the cytoplasm during G1 phase. Nuclear levels decrease during S-phase; upon entering mitosis, relocalizes in the cytoplasm without association with chromatin.
  • Information by UniProt

Recombinant Human hHR23b protein images

  • 12.5% SDS-PAGE showing ab114493 at approximately 36.52kDa stained with Coomassie Blue.

References for Recombinant Human hHR23b protein (ab114493)

ab114493 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"