Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLA KFTAELGLSPDKAAEVLSQGAHLAAGPDG
    • Molecular weight
      34 kDa including tags
    • Amino acids
      627 to 705

Specifications

Our Abpromise guarantee covers the use of ab114655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hic 1
    • HIC ZBTB transcriptional repressor 1
    • Hic-1
    • Hic1
    • HIC1_HUMAN
    • Hypermethylated in cancer 1
    • Hypermethylated in cancer 1 protein
    • ZBTB29
    • Zinc finger and BTB domain-containing protein 29
    • ZNF901
    see all
  • Function
    Transcriptional repressor. May act as a tumor suppressor. May be involved in development of head, face, limbs and ventral body wall.
  • Tissue specificity
    Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 5 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Acetylated on several residues, including Lys-333. Lys-333 is deacetylated by SIRT1.
    Sumoylated on Lys-333 by a PIAS family member, which positively regulates transcriptional repression ativity and is enhanced by HDAC4.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114655 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up