Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPR SPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPS SKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSD FRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSR RGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFF EKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCG EPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCV SALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 444

Specifications

Our Abpromise guarantee covers the use of ab132455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Androgen receptor coactivator 55 kDa protein
    • Androgen receptor coactivator ARA55
    • Androgen receptor-associated protein of 55 kDa
    • ARA55
    • Hic-5
    • Hydrogen peroxide-inducible clone 5 protein
    • Tgfb1i1
    • TGFI1_HUMAN
    • Transforming growth factor beta 1 induced transcript 1
    • Transforming growth factor beta-1-induced transcript 1 protein
    • TSC 5
    see all
  • Function
    Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signaling pathways. May also regulate SLC6A3 and SLC6A4 targeting to the plasma membrane hence regulating their activity. In the nucleus, functions as a nuclear receptor coactivator regulating glucocorticoid, androgen, mineralocorticoid and progesterone receptor transcriptional activity. May play a role in the processes of cell growth, proliferation, migration, differentiation and senescence. May have a zinc-dependent DNA-binding activity.
  • Tissue specificity
    Expressed in platelets, smooth muscle and prostate stromal cells (at protein level).
  • Sequence similarities
    Belongs to the paxillin family.
    Contains 4 LIM zinc-binding domains.
  • Domain
    The LIM zinc-binding domains mediate glucocorticoid receptor coactivation and interaction with AR, CRIP2, ILK, LIMS1, NR3C1, PPARG, TCF3, TCF7L2, SLC6A3 and SMAD3. The LIM zinc-binding 2 and LIM zinc-binding 3 domains mediate targeting to focal adhesions and actin stress fibers. The LIM zinc-binding 3 and LIM zinc-binding 4 domains mediate interaction with TRAF4 and MAPK15. The LIM zinc-binding 4 domain mediates interaction with HSPB1, homooligomerization and targeting to the nuclear matrix. The LIM zinc-binding 3 domain mediates interaction with PTPN12.
    The LD (leucine and aspartate-rich) motif 3 mediates interaction with GIT1 and functions as a nuclear export signal.
  • Post-translational
    modifications
    Phosphorylated by gonadotropin-releasing hormone-activated SRC.
  • Cellular localization
    Cell junction > focal adhesion. Nucleus matrix. Cytoplasm > cytoskeleton. Associated with the actin cytoskeleton; colocalizes with stress fibers.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132455 on a 12.5% gel stained with Coomassie Blue.

References

ab132455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up