Recombinant Human HIF-2-alpha protein (ab114171)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99814
    • SpeciesHuman
    • SequenceSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSEN ESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELT GHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVT NRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCE PIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSA YEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIY NPRNLQPQCIMCVNYVLSEI
    • Molecular weight61 kDa including tags
    • Amino acids28 to 347

Specifications

Our Abpromise guarantee covers the use of ab114171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic helix loop helix PAS protein MOP2
    • Basic-helix-loop-helix-PAS protein MOP2
    • bHLHe73
    • Class E basic helix-loop-helix protein 73
    • ECYT4
    • Endothelial PAS domain containing protein 1
    • Endothelial pas domain protein 1
    • Endothelial PAS domain-containing protein 1
    • EPAS 1
    • EPAS-1
    • EPAS1
    • EPAS1_HUMAN
    • HIF 1 alpha like factor
    • HIF 2 alpha
    • HIF-1-alpha-like factor
    • HIF-2-alpha
    • HIF2-alpha
    • HIF2A
    • HLF
    • Hypoxia inducible factor 2 alpha
    • Hypoxia inducible factor 2 alpha subunit
    • Hypoxia-inducible factor 2-alpha
    • Member of PAS protein 2
    • Member of pas superfamily 2
    • MOP 2
    • MOP2
    • PAS domain-containing protein 2
    • PASD2
    see all
  • FunctionTranscription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD.
  • Tissue specificityExpressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells.
  • Involvement in diseaseDefects in EPAS1 are the cause of erythrocytosis familial type 4 (ECYT4) [MIM:611783]. ECYT4 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated hemoglobin concentration and hematocrit, and normal platelet and leukocyte counts.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Post-translational
    modifications
    In normoxia, is probably hydroxylated on Pro-405 and Pro-531 by EGLN1/PHD1, EGLN2/PHD2 and/or EGLN3/PHD3. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization.
    In normoxia, is hydroxylated on Asn-847 by HIF1AN thus probably abrogating interaction with CREBBP and EP300 and preventing transcriptional activation.
    Phosphorylated on multiple sites in the CTAD.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of asparagine is (S) stereospecific within HIF CTAD domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HIF-2-alpha protein images

  • ab114171 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human HIF-2-alpha protein (ab114171)

ab114171 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"