Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGT QQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQY S
    • Amino acids
      330 to 430
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hipk 1
    • Hipk1
    • HIPK1_HUMAN
    • Homeodomain interacting protein kinase 1
    • Homeodomain interacting protein kinase 1 like protein
    • Homeodomain-interacting protein kinase 1
    • Myak
    • Nbak 2
    • Nbak2
    • Nuclear body associated kinase 2
    • Nuclear body associated kinase 2b
    see all
  • Function
    May play a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. May be involved in malignant squamous cell tumor formation.
  • Tissue specificity
    Ubiquitously expressed with highest levels in skeletal muscle and heart. Overexpressed in breast cancer cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Phosphorylated and activated by JNK1.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear.
  • Information by UniProt

Images

  • ab165908 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up