Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRI HVDQMHQHRSGIESALKETKGFLDKLHNEITRTLEKISSREKYINNQLE
    • Amino acids
      214 to 312
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDNA FLJ10147 fis clone HEMBA1003369
    • Dermal papilla derived protein 8
    • Dermal papilla-derived protein 8
    • DERP 8
    • DERP8
    • Esrrbl 1
    • Esrrbl1
    • ESRRBL1 protein
    • Estrogen related receptor beta like 1
    • Estrogen related receptor beta like protein 1
    • Estrogen-related receptor beta-like protein 1
    • FLJ10147
    • Hip1 Interacting protein
    • HIP1 interacting protein HIPPI
    • Hip1 protein interactor
    • HIP1-interacting protein
    • HIPPI
    • Huntingtin interacting protein 1 interacting protein
    • Huntingtin interacting protein 1 protein interactor
    • IFT 57
    • ift57
    • IFT57_HUMAN
    • Intraflagellar transport 57 homolog
    • Intraflagellar transport 57 homolog (Chlamydomonas)
    • Intraflagellar transport protein 57 homolog
    • MHS4R2
    • Vestrogen related receptor beta like 1
    see all
  • Function
    Required for the formation of cilia. Plays an indirect role in sonic hedgehog signaling, cilia being required for all activity of the hedgehog pathway (By similarity). Has pro-apoptotic function via its interaction with HIP1, leading to recruit caspase-8 (CASP8) and trigger apoptosis. Has the ability to bind DNA sequence motif 5'-AAAGACATG-3' present in the promoter of caspase genes such as CASP1, CASP8 and CASP10, suggesting that it may act as a transcription regulator; however the relevance of such function remains unclear.
  • Tissue specificity
    Present in many tissues such as brain, thymus, lymph node, lung, liver, skin and kidney (at protein level).
  • Sequence similarities
    Belongs to the IFT57 family.
  • Domain
    The pseudo DED region (pDED) meadiates the interaction with HIP1.
  • Cellular localization
    Cytoplasm > cytoskeleton > cilium basal body. Concentrates within the inner segment of cilia.
  • Information by UniProt

Images

  • ab162954 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up