Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLRE ICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTEC QEQLDILRDK
    • Molecular weight
      38 kDa including tags
    • Amino acids
      908 to 1017

Specifications

Our Abpromise guarantee covers the use of ab152774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGCR1
    • DiGeorge critical region gene 1
    • HIR
    • HIR histone cell cycle regulation defective homolog A
    • HIRA
    • HIRA protein
    • HIRA_HUMAN
    • Histone cell cycle regulator
    • Protein HIRA
    • TUP 1
    • TUP1 like enhancer of split protein 1
    • TUP1-like enhancer of split protein 1
    • TUPLE1
    see all
  • Function
    Cooperates with ASF1A to promote replication-independent chromatin assembly. Required for the periodic repression of histone gene transcription during the cell cycle. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.
  • Tissue specificity
    Expressed at high levels in kidney, pancreas and skeletal muscle and at lower levels in brain, heart, liver, lung, and placenta.
  • Sequence similarities
    Belongs to the WD repeat HIR1 family.
    Contains 8 WD repeats.
  • Developmental stage
    Expressed during embryogenesis.
  • Post-translational
    modifications
    Sumoylated.
    Phosphorylated by CDK2/CCNA1 and CDK2/CCNE1 on Thr-555 in vitro. Also phosphorylated on Thr-555 and Ser-687 in vivo.
  • Cellular localization
    Nucleus. Nucleus > PML body. Primarily, though not exclusively, localized to the nucleus. Localizes to PML bodies immediately prior to onset of senescence.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152774 stained with Coomassie Blue.

References

ab152774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up