Recombinant Human Histatin-3 protein (ab158710)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYD N
    • Amino acids
      1 to 51
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic histidine-rich protein
    • HIS3
    • His3 1/11
    • His3 1/12
    • His3 1/13
    • His3 1/24
    • His3 1/25
    • His3 12/24
    • His3 12/25
    • His3 12/32
    • His3 13/24
    • His3 13/25
    • His3 14/24
    • His3 14/25
    • His3 15/24
    • His3 15/25
    • His3 20/30
    • His3 20/31
    • His3 20/32
    • His3 20/43
    • His3 20/44
    • His3 24/30
    • His3 24/31
    • His3 24/32
    • His3 25/30
    • His3 25/32
    • His3 26/30
    • His3 26/31
    • His3 26/32
    • His3 28/32
    • His3 29/32
    • His3 31/43
    • His3 31/44
    • His3 31/51
    • His3 32-43
    • His3 32/44
    • His3 33/43
    • His3 33/44
    • His3 34/43
    • His3 34/44
    • His3 45/51
    • His3 47/51
    • His3 48/51
    • His3 5/11
    • His3 5/12
    • His3 5/13
    • His3 6/11
    • His3 6/13
    • His3 7/11
    • His3 7/12
    • His3 7/13
    • His3-(1-11)-peptide
    • His3-(1-12)-peptide
    • His3-(1-13)-peptide
    • His3-(1-24)-peptide
    • His3-(1-25)-peptide
    • His3-(12-24)-peptide
    • His3-(12-25)-peptide
    • His3-(12-32)-peptide
    • His3-(13-24)-peptide
    • His3-(13-25)-peptide
    • His3-(14-24)-peptide
    • His3-(14-25)-peptide
    • His3-(15-24)-peptide
    • His3-(15-25)-peptide
    • His3-(26-32)-peptide
    • His3-(28-32)-peptide
    • His3-(29-32)-peptide
    • His3-(48-51)-peptide
    • His3-(5-11)-peptide
    • His3-(5-12)-peptide
    • His3-(5-13)-peptide
    • His3-(6-11)-peptide
    • His3-(6-13)-peptide
    • His3-(7-11)-peptide
    • His3-(7-12)-peptide
    • His3-(7-13)-peptide
    • HIS3_HUMAN
    • Histatin 3
    • Histatin-10
    • Histatin-11
    • Histatin-12
    • Histatin-3 1/11
    • Histatin-3 1/12
    • Histatin-3 1/13
    • Histatin-3 1/24
    • Histatin-3 1/25
    • Histatin-3 12/24
    • Histatin-3 12/25
    • Histatin-3 12/32
    • Histatin-3 13/24
    • Histatin-3 13/25
    • Histatin-3 14/24
    • Histatin-3 14/25
    • Histatin-3 15/24
    • Histatin-3 15/25
    • Histatin-3 26/32
    • Histatin-3 28/32
    • Histatin-3 29/32
    • Histatin-3 5/11
    • Histatin-3 5/12
    • Histatin-3 5/13
    • Histatin-3 6/11
    • Histatin-3 6/13
    • Histatin-3 7/11
    • Histatin-3 7/12
    • Histatin-3 7/13
    • Histatin-4
    • Histatin-5
    • Histatin-6
    • Histatin-7
    • Histatin-8
    • Histatin-9
    • Histidine-rich protein 3
    • Hst
    • HTN3
    • HTN5
    • NTN2
    • PB
    see all
  • Function
    Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. His3-(20-43)-peptide (histatin-5) is especially effective against C.albicans and C.neoformans, and inhibits Lys-gingipain and Arg-gingipain (rgpB) from P.gingivalis. In addition, His3-(20-43)-peptide is a potent inhibitor of metalloproteinases MMP2 and MMP9.
  • Sequence similarities
    Belongs to the histatin/statherin family.
  • Post-translational
    modifications
    24 proteolytic products are found in saliva.
  • Cellular localization
    Secreted. Secreted by serous acinar and demilune cells.
  • Information by UniProt

Images

  • ab158710 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up