Recombinant Human Histone H2A.Z Recombinant Protein (ab114184)

Overview

  • Product name
    Recombinant Human Histone H2A.Z Recombinant Protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGAT AAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL IKATIAGGGVIPHIHKSLIGKKGQQKTV
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 128

Specifications

Our Abpromise guarantee covers the use of ab114184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

Images

  • ab114184 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up