Recombinant Human Histone H2A.Z Recombinant Protein (ab114184)

Overview

  • Product name
    Recombinant Human Histone H2A.Z Recombinant Protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGAT AAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL IKATIAGGGVIPHIHKSLIGKKGQQKTV
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 128

Specifications

Our Abpromise guarantee covers the use of ab114184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

Recombinant Human Histone H2A.Z Recombinant Protein images

  • ab114184 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Histone H2A.Z Recombinant Protein (ab114184)

ab114184 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up