Recombinant Human Histone H4 protein (ab112431)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62805
    • SpeciesHuman
    • SequenceMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL IYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG FGG
    • Molecular weight37 kDa including tags
    • Amino acids1 to 103
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ160A22.1
    • dJ160A22.2
    • dJ221C16.1
    • dJ221C16.9
    • FO108
    • H4
    • H4.k
    • H4/a
    • H4/b
    • H4/c
    • H4/d
    • H4/e
    • H4/g
    • H4/h
    • H4/I
    • H4/j
    • H4/k
    • H4/m
    • H4/n
    • H4/p
    • H4_HUMAN
    • H4F2
    • H4F2iii
    • H4F2iv
    • H4FA
    • H4FB
    • H4FC
    • H4FD
    • H4FE
    • H4FG
    • H4FH
    • H4FI
    • H4FJ
    • H4FK
    • H4FM
    • H4FN
    • H4M
    • HIST1H4A
    • HIST1H4B
    • HIST1H4C
    • HIST1H4D
    • HIST1H4E
    • HIST1H4F
    • HIST1H4H
    • HIST1H4I
    • HIST1H4J
    • HIST1H4K
    • HIST1H4L
    • HIST2H4
    • HIST2H4A
    • Hist4h4
    • Histone 1 H4a
    • Histone 1 H4b
    • Histone 1 H4c
    • Histone 1 H4d
    • Histone 1 H4e
    • Histone 1 H4f
    • Histone 1 H4h
    • Histone 1 H4i
    • Histone 1 H4j
    • Histone 1 H4k
    • Histone 1 H4l
    • Histone 2 H4a
    • histone 4 H4
    • Histone H4
    • MGC24116
    see all
  • FunctionCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  • Sequence similaritiesBelongs to the histone H4 family.
  • Post-translational
    modifications
    Acetylation at Lys-6 (H4K5ac), Lys-9 (H4K8ac), Lys-13 (H4K12ac) and Lys-17 (H4K16ac) occurs in coding regions of the genome but not in heterochromatin.
    Citrullination at Arg-4 (H4R3ci) by PADI4 impairs methylation.
    Monomethylation and asymmetric dimethylation at Arg-4 (H4R3me1 and H4R3me2a, respectively) by PRMT1 favors acetylation at Lys-9 (H4K8ac) and Lys-13 (H4K12ac). Demethylation is performed by JMJD6. Symmetric dimethylation on Arg-4 (H4R3me2s) by the PRDM1/PRMT5 complex may play a crucial role in the germ-cell lineage.
    Monomethylated, dimethylated or trimethylated at Lys-21 (H4K20me1, H4K20me2, H4K20me3). Monomethylation is performed by SET8. Trimethylation is performed by SUV420H1 and SUV420H2 and induces gene silencing.
    Ubiquitinated by the CUL4-DDB-RBX1 complex in response to ultraviolet irradiation. This may weaken the interaction between histones and DNA and facilitate DNA accessibility to repair proteins. Monoubiquitinated at Lys-92 of histone H4 (H4K91ub1) in response to DNA damage. The exact role of H4K91ub1 in DNA damage response is still unclear but it may function as a licensing signal for additional histone H4 post-translational modifications such as H4 Lys-21 methylation (H4K20me).
    Sumoylated, which is associated with transcriptional repression.
  • Cellular localizationNucleus. Chromosome.
  • Information by UniProt

Recombinant Human Histone H4 protein images

  • ab112431 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Histone H4 protein (ab112431)

ab112431 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

ab112431is the full length protein of 103 amino acids, whereas ab4559 is only a peptide. A peptide is defined as a short polymer of less than 50 amino acids. The sequence of ab4559can be foundfrom position 50 AA ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"