Recombinant Human HLA DM protein (ab116751)

Overview

  • Product nameRecombinant Human HLA DM protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28067
    • SpeciesHuman
    • SequenceMGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYC QDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILF DKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVS NLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIF SCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVL IIYFRKPCSGD
    • Molecular weight54 kDa
    • Amino acids1 to 261

Specifications

Our Abpromise guarantee covers the use of ab116751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Class II histocompatibility antigen M alpha chain
    • D6S222E
    • DMA
    • HLA class II histocompatibility antigen DM alpha chain
    • HLA DMA
    • HLADM
    • Major histocompatibility complex class II DM alpha
    • MHC class II antigen DMA
    • OTTHUMP00000029242
    • OTTHUMP00000062997
    • OTTHUMP00000178727
    • OTTHUMP00000178728
    • OTTHUMP00000178729
    • Really interesting new gene 6 protein
    • Ring 6
    • Ring6
    see all
  • RelevanceHuman Leukocyte Antigens are highly polymorphic proteins that are involved in the presentation of antigens to the T-cell receptor. There are two classes of HLA antigens, class I (HLA-A, HLA-B and HLA-C) and class II (HLA-D). This antibody can be used for HLA typing. HLA DM plays a critical role in catalyzing the release of class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.
  • Cellular localizationLate endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note: Localizes to late endocytic compartment. Associates with lysosome membranes.

Recombinant Human HLA DM protein images

  • 12.5% SDS-PAGE analysis of ab116751 at approximately 54.45kDa, stained with Coomassie Blue.

References for Recombinant Human HLA DM protein (ab116751)

ab116751 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"