Recombinant Human HLA DMA protein (ab116751)

Overview

  • Product name
    Recombinant Human HLA DMA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYC QDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILF DKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVS NLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIF SCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVL IIYFRKPCSGD
    • Molecular weight
      54 kDa
    • Amino acids
      1 to 261

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Class II histocompatibility antigen M alpha chain
    • D6S222E
    • DMA
    • HLA class II histocompatibility antigen DM alpha chain
    • HLA DMA
    • HLADM
    • Major histocompatibility complex class II DM alpha
    • MHC class II antigen DMA
    • OTTHUMP00000029242
    • OTTHUMP00000062997
    • OTTHUMP00000178727
    • OTTHUMP00000178728
    • OTTHUMP00000178729
    • Really interesting new gene 6 protein
    • Ring 6
    • Ring6
    see all
  • Relevance
    Human Leukocyte Antigens are highly polymorphic proteins that are involved in the presentation of antigens to the T-cell receptor. There are two classes of HLA antigens, class I (HLA-A, HLA-B and HLA-C) and class II (HLA-D). This antibody can be used for HLA typing. HLA DM plays a critical role in catalyzing the release of class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.
  • Cellular localization
    Late endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note: Localizes to late endocytic compartment. Associates with lysosome membranes.

Images

  • 12.5% SDS-PAGE analysis of ab116751 at approximately 54.45kDa, stained with Coomassie Blue.

References

ab116751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up