Recombinant Human HLA-DQA1 protein (ab114250)

Overview

  • Product name
    Recombinant Human HLA-DQA1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPE FSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
    • Molecular weight
      35 kDa including tags
    • Amino acids
      24 to 110

Specifications

Our Abpromise guarantee covers the use of ab114250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD
    • CELIAC1
    • DC 1 alpha chain
    • DC alpha
    • DC-1 alpha chain
    • DC-alpha
    • DC1, included
    • DQ alpha 1 chain
    • DQ-A1
    • DQ-DRW9 alpha chain
    • DQA1_HUMAN
    • FLJ27088
    • FLJ27328
    • Gluten-sensitive enteropathy (celiac disease)
    • GSE
    • HLA class II histocompatibility antigen
    • HLA class II histocompatibility antigen, DQ alpha 1 chain
    • HLA class II histocompatibility antigen, DQ(W3) alpha chain
    • HLA-DCA
    • HLA-DQA
    • HLA-DQA1
    • HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1
    • HLADC histocompatibility type
    • Immune response antigens HIa, included
    • leucocyte antigen DQA1
    • leukocyte antigen alpha chain
    • LOC100133678
    • LOC100507686
    • LOC100509457
    • Major histocompatibility complex, class II, DQ alpha 1
    • MGC149527
    • MHC class II antigen
    • MHC class II DQA1
    • MHC class II HLA-D alpha glycoprotein
    • MHC class II HLA-DQ alpha 1
    • MHC class II surface glycoprotein
    • MHC HLA-DQ alpha
    • OTTHUMP00000029141
    • OTTHUMP00000176885
    • OTTHUMP00000178551
    • OTTHUMP00000178552
    • OTTHUMP00000233817
    see all
  • Function
    Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accomodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form an heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal miroenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
  • Sequence similarities
    Belongs to the MHC class II family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus > trans-Golgi network membrane. Endosome membrane. Lysosome membrane. The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation.
  • Information by UniProt

Images

  • ab114250 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up