Recombinant Human HLA-DQB2 protein (ab158659)

Overview

  • Product name
    Recombinant Human HLA-DQB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFT NGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLE QERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSV TDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGD IYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
    • Amino acids
      1 to 231
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB))
    • DX-beta
    • HLA class II histocompatibility antigen, DQ beta 2 chain
    • HLA class II histocompatibility antigen, DX beta chain
    • HLA DQB1
    • HLA DXB
    • major histocompatibility complex, class II, DQ beta 1
    • Major histocompatibility complex, class II, DQ beta 2
    • Major histocompatibility complex, class II, DX beta
    • MHC class II antigen DQB2
    see all
  • Relevance
    Belongs to the MHC class II family. Contains one Ig like C1 type (immunoglobulin like) domain.
  • Cellular localization
    Cell membrane; Single pass type I membrane protein

Images

  • ab158659 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up