Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16534
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEKMSRPLPLNPTFIPPPYGVLRSLLENPL KLPLHHEDAFSKDKDKEK KLDDESNSPTVPQSAFLGPTLWDKTLPYDG DTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSV MDL SSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYE PDPADLALSSIPGQEMFDPRKR KFSEEELKPQPMIKKARKVFIPDDLK DDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVAD LRKELGKCKNILAKYEARHGPL
    • Molecular weight35 kDa including tags
    • Amino acids1 to 295
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    > 85% by SDS - PAGE. ab113145 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride, 0.002% PMSF

General Info

  • Alternative names
    • Hepatic leukemia factor
    • Hlf
    • HLF/E2A FUSION GENE
    • HLF_HUMAN
  • Tissue specificityHighly expressed in liver; lower levels in lung and kidney.
  • Involvement in diseaseNote=A chromosomal aberration involving HLF is a cause of pre-B-cell acute lymphoblastic leukemia (B-ALL). Translocation t(17;19)(q22;p13.3) with TCF3.
  • Sequence similaritiesBelongs to the bZIP family. PAR subfamily.
    Contains 1 bZIP domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HLF protein images

  • 15% SDS-PAGE analysis of ab113145 (3µg)

References for Recombinant Human HLF protein (ab113145)

ab113145 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"