Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELA AGAFGTKKPNADEMKQAKINEIRTLIDL
    • Molecular weight
      34 kDa including tags
    • Amino acids
      932 to 1009

Specifications

Our Abpromise guarantee covers the use of ab152692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA-binding protein/plasminogen activator inhibitor 1 regulator
    • Helicase like transcription factor
    • Helicase-like transcription factor
    • HIP116
    • HIP116A
    • Hltf
    • HLTF 1
    • HLTF_HUMAN
    • HLTF1
    • p113
    • RING finger protein 80
    • RNF80
    • SMARC A3
    • SMARCA 3
    • SMARCA3
    • SNF2-like 3
    • SNF2L3
    • Sucrose nonfermenting protein 2 like 3
    • Sucrose nonfermenting protein 2-like 3
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 3
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a3
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3
    • ZBU 1
    • ZBU1
    see all
  • Function
    Has both helicase and E3 ubiquitin ligase activities. Possesses intrinsic ATP-dependent nucleosome-remodeling activity; This activity may be required for transcriptional activation or repression of specific target promoters (By similarity). These may include the SERPINE1 and HIV-1 promoters and the SV40 enhancer, to which this protein can bind directly. Plays a role in error-free postreplication repair (PRR) of damaged DNA and maintains genomic stability through acting as a ubiquitin ligase for 'Lys-63'-linked polyubiquitination of chromatin-bound PCNA.
  • Tissue specificity
    Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family. RAD16 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus, nucleolus. Nucleus, nucleoplasm. Nuclear localization is stimulated by progesterone.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152692 stained with Coomassie Blue.

References

ab152692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up