Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14774
    • SpeciesHuman
    • SequenceFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFA SLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRK RSWS
    • Molecular weight37 kDa including tags
    • Amino acids176 to 279

Specifications

Our Abpromise guarantee covers the use of ab117058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.5% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • H2.0 like homeo box 1
    • H2.0 like homeobox 1
    • H2.0 like homeobox 1 Drosophila
    • H2.0-like homeobox protein
    • HB24
    • HLX
    • HLX_HUMAN
    • Homeobox protein HB24
    • Homeobox protein HLX1
    see all
  • FunctionTranscription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis.
  • Tissue specificityLow level in normal B and T-cells, high level in activated lymphocytes and monocytes. Also found in thymus, tonsil, bone marrow, developing vessels, and fetal brain.
  • Sequence similaritiesBelongs to the H2.0 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HLX1 protein images

  • 12.5% SDS-PAGE showing ab117058 at approximately 37.07 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HLX1 protein (ab117058)

ab117058 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"