Recombinant Human HMG1L10 protein (ab88175)

Overview

  • Product nameRecombinant Human HMG1L10 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMSKGDPKKLRGKMSSHAFFGQTCREAHKKKHPDASVNLSEFSKKCSERWK TMSAKEKGK FEDMAKADKAHYEREMKTYIPPKGETKKKFKDPNAPKRT PSAFFLFCSAYRPKIKGEHP GLSIGDVAKKLGEMWNNTAADDKQPYEK KAAKLKEKYEKDIAAYRAKGKPDAAKKGVVK AEKSKKKKEEEEDEEDE EDEEEEDEEDEDEEDDE

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88175 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • bK445C9.3
    • high mobility group (nonhistone chromosomal) protein 1 like 10
    • HMG 1L10
  • RelevanceHMG1L10 contains 2 HMG box DNA-binding domains and belongs to the HMGB family. It binds preferentially single-stranded DNA and unwinds double stranded DNA.
  • Cellular localizationNuclear

References for Recombinant Human HMG1L10 protein (ab88175)

ab88175 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"