Recombinant Human HMG2L1 protein (ab160774)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQ VRNSSKKKLKDSELYFLGTDTHKK
    • Amino acids
      1 to 74
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • High mobility group protein 2 like 1
    • HMG box domain containing 4
    • HMGBCG
    • HMGXB4
    • OTTHUMP00000028778
    • Protein HMGBCG
    • THC211630
    see all
  • Relevance
    HMG2L1 (High mobility group protein 2-like 1) contains an HMG box which is involved in DNA binding. The high mobility group (HMG) proteins are nonhistone chromosomal proteins. HMG1 and HMG2 are localized in the nuclei of higher eukaryotes, bind to single-stranded DNA, unwind double-stranded DNA, and increase transcription.
  • Cellular localization
    Nuclear

Images

  • ab160774 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up