Recombinant Human HMGA1a / HMGA1b protein (ab109927)

Overview

  • Product name
    Recombinant Human HMGA1a / HMGA1b protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSE VPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ ESSEEEQLEH HHHHH
    • Molecular weight
      13 kDa including tags
    • Amino acids
      1 to 107
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109927 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 50% Glycerol, 0.02% DTT, 0.32% Tris HCl, 1.12% Sodium chloride

General Info

  • Alternative names
    • High mobility group AT hook 1
    • High mobility group AT-hook protein 1
    • High mobility group protein A1
    • High mobility group protein HMG-I/HMG-Y
    • High mobility group protein R
    • HMG-I(Y)
    • HMGA 1a
    • HMGA 1b
    • HMGA1
    • HMGA1_HUMAN
    • HMGI
    • HMGI/Y
    • HMGR
    • HMGY
    see all
  • Function
    HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
  • Involvement in disease
    Note=A chromosomal aberration involving HMGA1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with RAD51L1.
  • Sequence similarities
    Belongs to the HMGA family.
    Contains 3 A.T hook DNA-binding domains.
  • Post-translational
    modifications
    Constitutively phosphorylated on two or three sites. Phosphorylated upon DNA damage, probably by ATM or ATR. Hyperphosphorylated at early stages of apoptosis, followed by dephosphorylation and methylation, which coincides with chromatin condensation. Isoform HMG-Y can be phosphorylated by HIPK2.
    HMG-Y is not methylated.
    Methylation at Arg-58 is mutually exclusive with methylation at Arg-60.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109927 at approximately 12.7 kDa (3µg).

References

ab109927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up