Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRG RPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 92

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HMGA 2
    • BABL
    • High mobility group (nonhistone chromosomal) protein isoform I C
    • High mobility group (nonhistone chromosomal) protein isoform IC
    • High Mobility Group AT hook 2
    • High Mobility Group AT hook protein 2
    • High mobility group AT-hook protein 2
    • High mobility group protein HMGI C
    • High mobility group protein HMGI-C
    • High mobility group protein HMGIC
    • High mobility group protein I, isoform C
    • HMGA2
    • HMGA2_HUMAN
    • HMGI C
    • HMGIC
    • LIPO
    • Non histone chromosomal architectural protein HMGI C
    • Non histone chromosomal architectural protein HMGIC
    • Pygmy
    • STQTL9
    see all
  • Function
    Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2.
  • Involvement in disease
    Note=A chromosomal aberration involving HMGA2 is associated with a subclass of benign mesenchymal tumors known as lipomas. Translocation t(3;12)(q27-q28;q13-q15) with LPP is shown in lipomas. HMGA2 is also fused with a number of other genes in lipomas.
    Note=A chromosomal aberration involving HMGA2 is associated with pulmonary chondroid hamartomas. Translocation t(3;12)(q27-q28;q14-q15) with LPP is detected in pulmonary chondroid hamartomas.
    Note=A chromosomal aberration involving HMGA2 is associated with parosteal lipomas. Translocation t(3;12)(q28;q14) with LPP is also shown in one parosteal lipoma.
    Note=A chromosomal aberration involving HMGA2 is found in uterine leiomyoma. Translocation t(12;14)(q15;q23-24) with RAD51L1. Chromosomal rearrangements involving HMGA2 do not seem to be the principle pathobiological mechanism in uterine leiomyoma.
  • Sequence similarities
    Belongs to the HMGA family.
    Contains 3 A.T hook DNA-binding domains.
  • Developmental stage
    Expressed predominantly during embryogenesis.
  • Post-translational
    modifications
    Regulated by cell cycle-dependent phosphorylation which alters its DNA binding affinity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152841 stained with Coomassie Blue.

References

ab152841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up