Overview

  • Product nameRecombinant Human HMGB2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceBaculovirus
  • Amino Acid Sequence
    • AccessionP26583
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEH KKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAK KLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGR PTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
    • Molecular weight26 kDa including tags
    • Amino acids1 to 209
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab109962 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C80539
    • High mobility group (nonhistone chromosomal) protein 2
    • High mobility group box 2
    • High mobility group protein 2
    • High mobility group protein B2
    • HMG 2
    • HMG B2
    • HMG-2
    • HMG2
    • HMGB2
    • HMGB2_HUMAN
    see all
  • FunctionDNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).
  • Sequence similaritiesBelongs to the HMGB family.
    Contains 2 HMG box DNA-binding domains.
  • Cellular localizationNucleus. Chromosome.
  • Information by UniProt

Recombinant Human HMGB2 protein images

  • 15% SDS-PAGE analysis of 3µg ab109962.

References for Recombinant Human HMGB2 protein (ab109962)

ab109962 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"