Overview

  • Product name
    Recombinant Human HMGB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEH KKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAK KLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGR PTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 209
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab109962 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C80539
    • High mobility group (nonhistone chromosomal) protein 2
    • High mobility group box 2
    • High mobility group protein 2
    • High mobility group protein B2
    • HMG 2
    • HMG B2
    • HMG-2
    • HMG2
    • HMGB2
    • HMGB2_HUMAN
    see all
  • Function
    DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).
  • Sequence similarities
    Belongs to the HMGB family.
    Contains 2 HMG box DNA-binding domains.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab109962.

References

ab109962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up