Recombinant Human HMGCS1 protein (ab114524)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VFAENMKLREDTYHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPT PNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      422 to 520

Specifications

Our Abpromise guarantee covers the use of ab114524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 hydroxy 3 methylglutaryl Coenzyme A synthase 1 (soluble)
    • 3-hydroxy-3-methylglutaryl coenzyme A synthase
    • cytoplasmic
    • EC 2.3.3.10
    • HMCS1_HUMAN
    • HMG CoA synthase
    • HMG-CoA synthase
    • HMGCS
    • HMGCS1
    • Hydroxymethylglutaryl CoA synthase, cytoplasmic
    • Hydroxymethylglutaryl-CoA synthase
    • MGC90332
    see all
  • Function
    This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
  • Pathway
    Metabolic intermediate biosynthesis; (R)-mevalonate biosynthesis; (R)-mevalonate from acetyl-CoA: step 2/3.
  • Sequence similarities
    Belongs to the HMG-CoA synthase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human HMGCS1 protein images

  • 12.5% SDS-PAGE showing ab114524 at approximately 36.52kDa stained with Coomassie Blue.

References for Recombinant Human HMGCS1 protein (ab114524)

ab114524 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up