Recombinant Human HMGCS2 protein (ab114900)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTW PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE DINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMELFQ DSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVY PSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEY PIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIF HTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNK DLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQ ELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLA SRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHR RKYARRPV
    • Molecular weight
      82 kDa including tags
    • Amino acids
      1 to 508

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 hydroxy 3 methylglutaryl coenzyme A synthase
    • 3 hydroxy 3 methylglutaryl Coenzyme A synthase 2
    • 3 hydroxy 3 methylglutaryl Coenzyme A synthase 2 (mitochondrial)
    • 3-hydroxy-3-methylglutaryl coenzyme A synthase
    • HMCS2_HUMAN
    • HMG CoA synthase
    • HMG-CoA synthase
    • HMGCS 2
    • HMGCS2
    • Hydroxymethylglutaryl CoA synthase
    • Hydroxymethylglutaryl CoA synthase mitochondrial
    • Hydroxymethylglutaryl-CoA synthase
    • mitochondrial
    see all
  • Function
    This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
  • Tissue specificity
    High expression in liver and colon. Low expression in testis, heart, skeletal muscle and kidney.
  • Pathway
    Metabolic intermediate biosynthesis; (R)-mevalonate biosynthesis; (R)-mevalonate from acetyl-CoA: step 2/3.
  • Involvement in disease
    Defects in HMGCS2 are the cause of HMG-CoA synthase deficiency (HMGCS deficiency) [MIM:605911]; also known as deficiency of mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase 2. Affected individuals present with severe hypoketotic hypoglycemia, mild hepatomegaly, or fatty liver, and a nondiagnostic pattern of urinary organic acids with increase of medium and short chain dicarboxylic acids.
  • Sequence similarities
    Belongs to the HMG-CoA synthase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human HMGCS2 protein images

  • 12.5% SDS-PAGE showing ab114900 at approximately 81.95kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HMGCS2 protein (ab114900)

ab114900 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up