Recombinant Human HNF-4-alpha protein (ab114232)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41235
    • SpeciesHuman
    • SequenceNDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEM LLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
    • Molecular weight37 kDa including tags
    • Amino acids324 to 423

Specifications

Our Abpromise guarantee covers the use of ab114232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ39654
    • FRTS4
    • Hepatic nuclear factor 4 alpha
    • Hepatocyte nuclear factor 4
    • Hepatocyte nuclear factor 4 alpha
    • Hepatocyte nuclear factor 4-alpha
    • HNF 4
    • HNF 4 alpha
    • HNF-4-alpha
    • HNF4
    • HNF4A
    • HNF4A_HUMAN
    • HNF4a7
    • HNF4a8
    • HNF4a9
    • Hnf4alpha
    • HNF4alpha10/11/12
    • MODY
    • MODY 1
    • MODY1
    • NR2A1
    • NR2A21
    • Nuclear receptor subfamily 2 group A member 1
    • OTTHUMP00000031060
    • OTTHUMP00000031062
    • TCF
    • TCF 14
    • TCF-14
    • TCF14
    • Tcf4
    • Transcription factor 14, hepatic nuclear factor
    • Transcription factor 14
    • Transcription factor HNF 4
    • Transcription factor HNF-4
    • Transcription factor HNF4
    see all
  • FunctionTranscriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine.
  • Involvement in diseaseDefects in HNF4A are the cause of maturity-onset diabetes of the young type 1 (MODY1) [MIM:125850]; also symbolized MODY-1. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HNF-4-alpha protein images

  • 12.5% SDS-PAGE showing ab114232 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human HNF-4-alpha protein (ab114232)

ab114232 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"