Recombinant Human HNF-4-alpha protein (ab114232)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEM LLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      324 to 423

Specifications

Our Abpromise guarantee covers the use of ab114232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ39654
    • FRTS4
    • Hepatic nuclear factor 4 alpha
    • Hepatocyte nuclear factor 4
    • Hepatocyte nuclear factor 4 alpha
    • Hepatocyte nuclear factor 4-alpha
    • HNF 4
    • HNF 4 alpha
    • HNF-4-alpha
    • HNF4
    • HNF4A
    • HNF4A_HUMAN
    • HNF4a7
    • HNF4a8
    • HNF4a9
    • Hnf4alpha
    • HNF4alpha10/11/12
    • MODY
    • MODY 1
    • MODY1
    • NR2A1
    • NR2A21
    • Nuclear receptor subfamily 2 group A member 1
    • OTTHUMP00000031060
    • OTTHUMP00000031062
    • TCF
    • TCF 14
    • TCF-14
    • TCF14
    • Tcf4
    • Transcription factor 14, hepatic nuclear factor
    • Transcription factor 14
    • Transcription factor HNF 4
    • Transcription factor HNF-4
    • Transcription factor HNF4
    see all
  • Function
    Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine.
  • Involvement in disease
    Defects in HNF4A are the cause of maturity-onset diabetes of the young type 1 (MODY1) [MIM:125850]; also symbolized MODY-1. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114232 at approximately 36.63kDa stained with Coomassie Blue.

References

ab114232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up