Recombinant Human HNF4 gamma protein (ab116986)

Overview

  • Product nameRecombinant Human HNF4 gamma protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14541
    • SpeciesHuman
    • SequenceKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPM STLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
    • Molecular weight36 kDa including tags
    • Amino acids310 to 407

Specifications

Our Abpromise guarantee covers the use of ab116986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hepatocyte nuclear factor 4 gamma
    • Hepatocyte nuclear factor 4-gamma
    • HNF 4 gamma
    • HNF-4-gamma
    • Hnf4g
    • HNF4G_HUMAN
    • NR2A2
    • NR2A3
    • Nuclear receptor subfamily 2 group A member 2
    see all
  • FunctionTranscription factor. Has a lower transcription activation potential than HNF4-alpha.
  • Tissue specificityExpressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HNF4 gamma protein images

  • 12.5% SDS-PAGE showing ab116986 at approximately 36.41 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HNF4 gamma protein (ab116986)

ab116986 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"