Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIG RIG DTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP SAEQIA KYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQK WDFIHMIQM LYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWD KLWKKYGSRFPQ DDLCQYITSDDLTQMLDNLGLKYECYDLLSTMD ISDCFIDGNENGDLL WDFLTETCNFNATAPPDLRAELGKDLQEPE FSAKKEGKVLFNNTLSFI VIEA

Specifications

Our Abpromise guarantee covers the use of ab88145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88145 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • EC 2.1.1.8
    • Histamine N methyltransferase
    • Histamine N-methyltransferase
    • HMT
    • HNMT
    • HNMT S1
    • HNMT S2
    • HNMT_HUMAN
    see all
  • FunctionInactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.
  • Sequence similaritiesBelongs to the methyltransferase superfamily. HNMT family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human HNMT protein (ab88145)

ab88145 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"