Recombinant Human hnRNP C1 + C2 protein (ab104668)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07910
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASNVTNKTDPRSMNSRVFIGNLNTLVVKK SDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVL DINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARV PPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDL QAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVK KDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEG EDDRDSANGEDDS
    • Molecular weight35 kDa including tags
    • Amino acids1 to 293
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab104668 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • C1
    • C2
    • Heterogeneous nuclear ribonucleoprotein C
    • Heterogeneous nuclear ribonucleoprotein C (C1/C2)
    • Heterogeneous nuclear ribonucleoproteins C1/C2
    • HNRNP
    • hnRNP C1 / hnRNP C2
    • hnRNP C1/C2
    • Hnrnpc
    • HNRPC
    • HNRPC_HUMAN
    • MGC104306
    • MGC105117
    • MGC117353
    • MGC131677
    • Nuclear ribonucleoprotein particle C1 protein
    • Nuclear ribonucleoprotein particle C2 protein
    • SNRPC
    see all
  • FunctionBinds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed:8264621). Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, a modification present at internal sites of mRNAs that affects mRNA splicing, processing and stability. M6A alters the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch' to facilitate binding of HNRNPC, leading to regulation of mRNA splicing (PubMed:25719671). Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides. May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed:12509468, PubMed:16010978, PubMed:7567451, PubMed:8264621).
  • Sequence similaritiesBelongs to the RRM HNRPC family. RALY subfamily.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated on Ser-260 and Ser-299 in resting cells. Phosphorylated on Ser-253 and on 1 serine residue in the poly-Ser stretch at position 238 in response to hydrogen peroxide.
    Sumoylated. Sumoylation reduces affinity for mRNA.
  • Cellular localizationNucleus. Component of ribonucleosomes.
  • Information by UniProt

Recombinant Human hnRNP C1 + C2 protein images

  • 15% SDS-PAGE showing ab104668 at approximately 34.5kDa (3µg).
    Note: Real molecular weight on SDS-PAGE is shifted up compared to predicted molecular weight.

References for Recombinant Human hnRNP C1 + C2 protein (ab104668)

ab104668 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"