Recombinant Human hnRNP F protein (ab114680)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTRE GRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHS GPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGK ITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLK FMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLS DGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKA TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGC YGAGYSGQNSMGGYD
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 415

Specifications

Our Abpromise guarantee covers the use of ab114680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Heterogeneous nuclear ribonucleoprotein F
    • hnRNP F
    • HnRNP F protein
    • Hnrnpf
    • HNRPF
    • HNRPF_HUMAN
    • mcs94 1
    • MGC110997
    • N-terminally processed
    • Nucleolin like protein
    • Nucleolin like protein mcs94 1
    • Nucleolin-like protein mcs94-1
    • OK/SW-cl.23
    • OTTHUMP00000019482
    • OTTHUMP00000043413
    • OTTHUMP00000043414
    • Ribonucleoprotein F
    see all
  • Function
    Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Plays a role in the regulation of alternative splicing events. Binds G-rich sequences in pre-mRNAs and keeps target RNA in an unfolded state.
  • Tissue specificity
    Expressed ubiquitously.
  • Sequence similarities
    Contains 3 RRM (RNA recognition motif) domains.
  • Domain
    The N-terminal RRM domains are responsible for recognizing the G-tract of BCL-X RNA.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Sumoylated.
  • Cellular localization
    Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • ab114680 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up