Recombinant Human hnRNP F protein (ab114680)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTRE GRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHS GPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGK ITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLK FMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLS DGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKA TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGC YGAGYSGQNSMGGYD
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 415

Specifications

Our Abpromise guarantee covers the use of ab114680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Heterogeneous nuclear ribonucleoprotein F
    • hnRNP F
    • HnRNP F protein
    • Hnrnpf
    • HNRPF
    • HNRPF_HUMAN
    • mcs94 1
    • MGC110997
    • N-terminally processed
    • Nucleolin like protein
    • Nucleolin like protein mcs94 1
    • Nucleolin-like protein mcs94-1
    • OK/SW-cl.23
    • OTTHUMP00000019482
    • OTTHUMP00000043413
    • OTTHUMP00000043414
    • Ribonucleoprotein F
    see all
  • Function
    Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Plays a role in the regulation of alternative splicing events. Binds G-rich sequences in pre-mRNAs and keeps target RNA in an unfolded state.
  • Tissue specificity
    Expressed ubiquitously.
  • Sequence similarities
    Contains 3 RRM (RNA recognition motif) domains.
  • Domain
    The N-terminal RRM domains are responsible for recognizing the G-tract of BCL-X RNA.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Sumoylated.
  • Cellular localization
    Nucleus > nucleoplasm.
  • Information by UniProt

Recombinant Human hnRNP F protein images

  • ab114680 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human hnRNP F protein (ab114680)

ab114680 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up