Recombinant Human hnRNP K protein (ab167846)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMETEQPEETFPNTETNGEFGKRPAEDM EEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVS VPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLES DAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTT IKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDP NFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPS
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 276
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab167846 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • CSBP
    • dC stretch binding protein
    • FLJ41122
    • Heterogeneous nuclear ribonucleoprotein K
    • hnRNP K
    • HNRNPK
    • HNRPK
    • HNRPK_HUMAN
    • Transformation up regulated nuclear protein
    • Transformation up-regulated nuclear protein
    • Transformation upregulated nuclear protein
    • TUNP
    see all
  • Function
    One of the major pre-mRNA-binding proteins. Binds tenaciously to poly(C) sequences. Likely to play a role in the nuclear metabolism of hnRNAs, particularly for pre-mRNAs that contain cytidine-rich sequences. Can also bind poly(C) single-stranded DNA.
  • Sequence similarities
    Contains 3 KH domains.
  • Post-translational
    modifications
    Arg-296 and Arg-299 are dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Cytoplasm. Nucleus > nucleoplasm. In case of ASFV infection, there is a shift in the localization which becomes predominantly nuclear.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab167846.

References

ab167846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up