Recombinant Human hnRNP U protein (ab152451)

Overview

  • Product name
    Recombinant Human hnRNP U protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIP EEYTFIQNV
    • Molecular weight
      38 kDa including tags
    • Amino acids
      371 to 479
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Heterogeneous nuclear ribonucleoprotein U
    • hnRNP U
    • hnRNP U protein
    • HNRNPU
    • hnRNPU protein
    • HNRPU
    • HNRPU_HUMAN
    • p120
    • p120 nuclear protein
    • pp120
    • SAF A
    • SAF-A
    • SAFA
    • Scaffold attachment factor A
    • U21.1
    see all
  • Function
    Component of the CRD-mediated complex that promotes MYC mRNA stabilization. Binds to pre-mRNA. Has high affinity for scaffold-attached region (SAR) DNA. Binds to double- and single-stranded DNA and RNA.
  • Sequence similarities
    Contains 1 B30.2/SPRY domain.
    Contains 1 SAP domain.
  • Post-translational
    modifications
    Extensively phosphorylated.
    Arg-733 and Arg-739 are dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Nucleus. Cytoplasm. Cell surface. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Component of ribonucleosomes. Also found associated with the cell surface.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE gel showing ab152451 stained with Coomassie Blue

References

ab152451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up