Recombinant Human HNRNPA0 protein (ab132718)

Overview

  • Product name
    Recombinant Human HNRNPA0 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCF GFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKL FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHD AADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGR GGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGN GFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGY GGSSF
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 305
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Heterogeneous nuclear ribonucleoprotein A0
    • hnRNA binding protein
    • hnRNP A0
    • HNRNPA0
    • HNRPA0
    • ROA0_HUMAN
    see all
  • Function
    This protein is a component of ribonucleosomes.
  • Sequence similarities
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Arg-291 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Nucleus. Component of ribonucleosomes.
  • Information by UniProt

Images

  • ab132718 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up