Recombinant Human HNRPAB protein (ab116735)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVY QQQQYGSGGRGNRNRGNRGSGGGGGGGGQGSTNYGKSQRRGGHQNNYKPY
    • Molecular weight
      37 kDa including tags
    • Amino acids
      186 to 285

Specifications

Our Abpromise guarantee covers the use of ab116735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ABBP 1
    • ABBP-1
    • ABBP1
    • Apobec 1 binding protein 1
    • APOBEC1 binding protein 1
    • APOBEC1-binding protein 1
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide 1- protein 1
    • FLJ40338
    • Heterogeneous nuclear ribonucleoprotein A/B
    • hnRNP A/B
    • hnRNP type A/B protein
    • HNRNPAB
    • HNRPAB
    • ROAA_HUMAN
    see all
  • Function
    Binds single-stranded RNA. Has a high affinity for G-rich and U-rich regions of hnRNA. Also binds to APOB mRNA transcripts around the RNA editing site.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Dimethylation at Arg-322 is probably asymmetric.
  • Cellular localization
    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Recombinant Human HNRPAB protein images

  • 12.5% SDS-PAGE of ab116735 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human HNRPAB protein (ab116735)

ab116735 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up