Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDP AYFDENWLNRIKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTL PDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVV MTAIQELMSKESPVSAGNDAYVDLDRQLKKTTEELNEALSAKEEIAQRCH ELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQ LEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLK DEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQN TVSLEEELRKANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLK EKVDSLQKEKDRLRTERDSLKETIEELRCVQAQEGQLTTQGLMPLGSQES SDSLAAEIVTPEIREKLIRLQHENKMLKLNQEGSDNEKIALLQSLLDDAN LRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEDSVLLKKKLEE HLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQM EERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKE YEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQ ATSSRRSYPGHVQPATAR
    • Amino acids
      1 to 718
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ31058
    • h-hook3
    • hHK3
    • HK3
    • hook3
    • HOOK3_HUMAN
    • OTTHUMP00000229200
    • Protein Hook homolog 3
    see all
  • Function
    Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking (By similarity). Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex.
  • Sequence similarities
    Belongs to the hook family.
  • Cellular localization
    Cytoplasm > cytoskeleton. Golgi apparatus. Enriched at the cis-face of the Golgi complex (By similarity). Localizes to microtubule asters in prophase.
  • Information by UniProt

Images

  • ab164584 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up